Protein coding transcript 124945

• Transcript: Ll_transcript_464946
• CDS coordinates: 3-377 (+)
• Peptide sequence: GNPVYGNLGLYTIHINFPNLVWTKENKVQLLIALEKLLEDHTGRYATGDEVFLADVFLAPQLYSAFTRFNIHKVVFCPLSRLYLCSGRVEDGNRMFDLYGYGTDTIVFFYQGCDLHSLIIKSLM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_464946

• Blastp: Glutathione S-transferase zeta class from Euphorbia sect. Esula with 45.45% of identity
• Blastx: Glutathione S-transferase zeta class from Euphorbia sect. Esula with 45.45% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436150.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;