Protein coding transcript 124948

• Transcript: Ll_transcript_464953
• CDS coordinates: 250-600 (+)
• Peptide sequence: MAAESVIEENKLTLYSYWRSSCSFRLRIALNLKSLSYHYKSVNLLKGEQSHPEFLKLNPVGFVPVLVDGPVVLTDSFAIIMVSHSNPPSLFNSIVYSQFYFFRNFFHDFLNLCKTN*
• ORF Type: complete

Annotations of Ll_transcript_464953

• Blastp: Glutathione S-transferase zeta class from Euphorbia sect. Esula with 66.67% of identity
• Blastx: Glutathione S-transferase zeta class from Euphorbia sect. Esula with 65% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436148.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF02798.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;