Protein coding transcript 124953

• Transcript: Ll_transcript_464967
• CDS coordinates: 305-733 (+)
• Peptide sequence: MYLEDKYPDRHPLLPNDILKRAVNFQAANIVSSLIQPLQNLSVLNYIGEKVSPDEKLPWAQTAIRKGFTALEKLLEDHTGRYATGDEVFLADVFLAPQLYSAFTRFNIHKDEFPILSRLYATYNNIPAFQEASPENQPDAVY*
• ORF Type: complete

Annotations of Ll_transcript_464967

• Blastp: Glutathione S-transferase zeta class from Euphorbia sect. Esula with 65.25% of identity
• Blastx: Glutathione S-transferase zeta class from Euphorbia sect. Esula with 67.77% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436148.1)
• Pfam: Glutathione S-transferase, C-terminal domain (PF14497.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;