Transcript | Ll_transcript_464342 |
---|---|
CDS coordinates | 19-351 (+) |
Peptide sequence | MASITSSKLLCFNPECKEFKSERPKKGWRLRTGDLAELCDRCGSAFEEGRFCDIFHSNASGWRNCETCRKGIHCGCIVSSHAFVLLDTGGIECFACARKHILLVGFSTLV* |
ORF Type | complete |
Blastp | B3 domain-containing protein Os07g0563300 from Oryza sativa with 63.74% of identity |
---|---|
Blastx | B3 domain-containing protein Os07g0563300 from Oryza sativa with 63.74% of identity |
Eggnog | B3 domain-containing protein(ENOG410Z235) |
Kegg | Link to kegg annotations (4343608) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418891.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer