Protein coding transcript 125071

• Transcript: Ll_transcript_464355
• CDS coordinates: 19-474 (+)
• Peptide sequence: MASITSSKLLCFNPECKEFKSERPKKGWRLRTGDLAELCDRCGSAFEEGRFCDIFHSNASGWRNCETCRKGIHCGCIVSSHAFVLLDPGGIECFACARKHILLVGFSIIVLRTYGPPPHPFGLNFFVWHECPVGFVDSFCSAFGEMNLKKV*
• ORF Type: complete

Annotations of Ll_transcript_464355

• Blastp: B3 domain-containing protein Os07g0563300 from Oryza sativa with 63.74% of identity
• Blastx: B3 domain-containing protein Os07g0563300 from Oryza sativa with 63.74% of identity
• Eggnog: B3 domain-containing protein(ENOG410Z235)
• Kegg: Link to kegg annotations (4343608)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418891.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;