Protein coding transcript 12508

• Transcript: Ll_transcript_411517
• CDS coordinates: 52-525 (+)
• Peptide sequence: MGVLPFHFLPPPCNASISPSPSSVEGANLNYAVSESLHNTVSTITGKKFPRRLILQILGLNHVICYASPALGAPIIPNMNEPEVIRTFKLPSGVRIQDIVEGEGPEAHGGDLVEFNYVCRRANGYFVYSTVDQFSGESKPVVLPLDENQVSFFHSTC*
• ORF Type: complete

Annotations of Ll_transcript_411517

• Blastp: Peptidyl-prolyl cis-trans isomerase FKBP16-1, chloroplastic from Arabidopsis with 64.55% of identity
• Blastx: Peptidyl-prolyl cis-trans isomerase FKBP16-1, chloroplastic from Arabidopsis with 64.55% of identity
• Eggnog: SFT2 domain containing(COG5102)
• Kegg: Link to kegg annotations (AT4G26555)
• CantataDB: Link to cantataDB annotations (CNT0002943)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447044.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;