Protein coding transcript 125094

• Transcript: Ll_transcript_462847
• CDS coordinates: 3-464 (+)
• Peptide sequence: VDQGENWVQPPAQNRTRRRVGGGRGRGRGGNATAVGKGPSPVVPTRRTAAGRGRRTRVIDLDPEPCDVLPVPEPVASGALEPIYNQVEVVANNNIVMEGGSGEKVVAAEEETSTTPVPERVQVGGSPVYKIERKQAQPQSPRGCKSVALLYIRL
• ORF Type: internal

Annotations of Ll_transcript_462847

• Blastp: Casein kinase 1-like protein HD16 from Oryza sativa with 44.68% of identity
• Blastx: Casein kinase 1-like protein HD16 from Oryza sativa with 46.91% of identity
• Eggnog: Casein Kinase(ENOG410XPGP)
• Kegg: Link to kegg annotations (4334396)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434417.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;