| Transcript | Ll_transcript_462836 |
|---|---|
| CDS coordinates | 3-440 (+) |
| Peptide sequence | VDQGENWVQPPAQNRTRRRVGGGRGRGRGGNATAVGKGPSPVVPTRRTAAGRGRGARVVDLDPEPCDVLPEPVALGAPEPVNNNIEVVANNNIVMEGGSGDKAVAAEEETSTTPVPERVFLCCLLLLLICIIAFPKYCCNLVFMM* |
| ORF Type | 5prime_partial |
| Blastp | Casein kinase 1-like protein HD16 from Oryza sativa with 45% of identity |
|---|---|
| Blastx | - |
| Eggnog | Casein Kinase(ENOG410XPGP) |
| Kegg | Link to kegg annotations (4334396) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019458465.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer