Protein coding transcript 12512

• Transcript: Ll_transcript_411522
• CDS coordinates: 52-621 (+)
• Peptide sequence: MGVLPFHFLPPPCNASISPSPSSVEGANLNYAVSESLHNTVSTITGKKFPRRLILQILGLNHVICYASPALGAPIIPNMNEPEVIRTFKLPSGVRIQDIVEGEGPEAHGGDLVEFNYVCRRANGYFVYSTVDQFSGESKPVVLPLDENQMIVGLKEVLTGMKLGGMFQDIVIIFLTNRHRLMNFTIILV*
• ORF Type: complete

Annotations of Ll_transcript_411522

• Blastp: Peptidyl-prolyl cis-trans isomerase FKBP16-1, chloroplastic from Arabidopsis with 62.6% of identity
• Blastx: Peptidyl-prolyl cis-trans isomerase FKBP16-1, chloroplastic from Arabidopsis with 62.6% of identity
• Eggnog: SFT2 domain containing(COG5102)
• Kegg: Link to kegg annotations (AT4G26555)
• CantataDB: Link to cantataDB annotations (CNT0002943)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447044.1)
• Pfam: FKBP-type peptidyl-prolyl cis-trans isomerase (PF00254.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;