Transcript | Ll_transcript_464487 |
---|---|
CDS coordinates | 2-463 (+) |
Peptide sequence | QRQKLDDRAIPCIFLGYGDEEFGYRLWDPESRRVIRSKDVVFHEQETMSDSATLEKTKKLGGNVDFTPVSLPRENAIGGGELNGHGVDDEPEPDDVGEEERVEQREQPPTPQLRRSYRERLPSSRYPSSEYILLIDEGEPESLDEVHTHKDKFE |
ORF Type | internal |
Blastp | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 45.06% of identity |
---|---|
Blastx | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 43.83% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020963654.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer