Transcript | Ll_transcript_464488 |
---|---|
CDS coordinates | 413-850 (+) |
Peptide sequence | MEKDAPKAIGIIRQWVDISVFHHVATETNAQTLWKNLQNLYERKTAQNKAFAIRKLVNLKYKEGRSVAEHLSDYQDLVNQLITMKVVLEDELQALLLLSSLSDSWETLVVSLSNSTSDGQLSLTQVKDNMFNEESKRKDLGTDNS* |
ORF Type | complete |
Blastp | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 32.08% of identity |
---|---|
Blastx | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 32.14% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016168674.1) |
Pfam | gag-polypeptide of LTR copia-type (PF14223.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer