| Transcript | Ll_transcript_464494 |
|---|---|
| CDS coordinates | 413-727 (+) |
| Peptide sequence | MEKDAPKAIGIIRQWVDISVFHHVATETNAQTLWKNLQNLYERKTAQNKAFAIRKLVNLKYKEGRSVAEHLSDYQDLVNQLITMKVVLEDELQALLLLSSLPDS* |
| ORF Type | complete |
| Blastp | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 34.69% of identity |
|---|---|
| Blastx | - |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_016168674.1) |
| Pfam | gag-polypeptide of LTR copia-type (PF14223.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer