Transcript | Ll_transcript_411525 |
---|---|
CDS coordinates | 52-705 (+) |
Peptide sequence | MGVLPFHFLPPPCNASISPSPSSVEGANLNYAVSESLHNTVSTITGKKFPRRLILQILGLNHVICYASPALGAPIIPNMNEPEVIRTFKLPSGVRIQDIVEGEGPEAHGGDLVEFNYVCRRANGYFVYSTVDQFSGESKPVVLPLDENQMIVGLKEVLTGMKLGGKRRALIPPSAGYVNENLKPIPEEFGPRRSLFSHAHEPLVFEVQLLKIWSLIL* |
ORF Type | complete |
Blastp | Peptidyl-prolyl cis-trans isomerase FKBP16-1, chloroplastic from Arabidopsis with 70.52% of identity |
---|---|
Blastx | Peptidyl-prolyl cis-trans isomerase FKBP16-1, chloroplastic from Arabidopsis with 70.52% of identity |
Eggnog | SFT2 domain containing(COG5102) |
Kegg | Link to kegg annotations (AT4G26555) |
CantataDB | Link to cantataDB annotations (CNT0002943) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447044.1) |
Pfam | FKBP-type peptidyl-prolyl cis-trans isomerase (PF00254.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer