Protein coding transcript 125221

• Transcript: Ll_transcript_465557
• CDS coordinates: 130-708 (+)
• Peptide sequence: MYQCQRYCSFSLSKFQSFIPHFQYPSFLLRFFSLSLNPTHLNNPLNHAVLSFNHMLHMRNTPTIFEFCKILGSIVKMKHYPIAISLFKRFDHVGIIPNIAAFNILLNCYCHLDQMHCAFSVLAKILKLGYDPDTITFTTLINGLCLNGDVKKALQFHDDLIRYGYQLDAITYGTLIKGLCKIGQTEAATQLLR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_465557

• Blastp: Pentatricopeptide repeat-containing protein At1g12300, mitochondrial from Arabidopsis with 42.18% of identity
• Blastx: Pentatricopeptide repeat-containing protein At1g12300, mitochondrial from Arabidopsis with 42.76% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT1G12300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414170.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;