Protein coding transcript 125224

• Transcript: Ll_transcript_465563
• CDS coordinates: 254-781 (+)
• Peptide sequence: MSKILGSIVKMKHYPIAISLFKRFDHVGIIPNIAAFNILLNCYCHLDQMHCAFSVLAKILKLGYDPDTITFTTLINGLCLNGDVKKALQFHDDLIRYGYQLDAITYGTLIKGLCKIGQTEAATQLLRNIESKVMKPNAVMYNTVIDSLCKDKLIARALDLYSKMVVTGISPDIFTY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_465563

• Blastp: Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial from Arabidopsis with 38.86% of identity
• Blastx: Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial from Arabidopsis with 38.83% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT1G12700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414170.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;