Protein coding transcript 125225

• Transcript: Ll_transcript_465564
• CDS coordinates: 30-740 (+)
• Peptide sequence: MDGYCLVNEVSKGKHLFSTMPQIGVTRNVQSYTIMINGFCKLKMMDEAMHLFKEMHHKNMIPDFVTYSSLIDGLCKTGRISHAWKLLDEMHDRGQPANVITYTSLLDALCKNKELDEAFALLKKIEDQGIQPDMYTYTVLIHGLCNVGRVETAKQVFQHFLIKGYHPNVWICNAMIWGLCKVDSFDQALALKSKMAENHCLPDAVTFETIIRALLEKNKNEDAKKLRSEMIARGLL*
• ORF Type: complete

Annotations of Ll_transcript_465564

• Blastp: Pentatricopeptide repeat-containing protein At3g22470, mitochondrial from Arabidopsis with 38.03% of identity
• Blastx: Pentatricopeptide repeat-containing protein At3g22470, mitochondrial from Arabidopsis with 39.64% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT3G22470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427053.1)
• Pfam: PPR repeat family (PF13041.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;