Protein coding transcript 125227

• Transcript: Ll_transcript_465548
• CDS coordinates: 2-445 (+)
• Peptide sequence: AMILKNVDPDVYTFSTLVDAFFKEGRVKEAKSLLAVMIKGGVKPDVVMYNSLMDGYCLVNEVSKGKHLFSTMPQMGVTPNVRSYNIIIKGLCELKMVDEAMNLFKEMQCKSMTPNTVTYSSLIDGLCKSGRISHAWKLLDEMHDRGQP
• ORF Type: internal

Annotations of Ll_transcript_465548

• Blastp: Pentatricopeptide repeat-containing protein At3g22470, mitochondrial from Arabidopsis with 44.22% of identity
• Blastx: Pentatricopeptide repeat-containing protein At3g22470, mitochondrial from Arabidopsis with 44.22% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT3G22470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413185.1)
• Pfam: PPR repeat (PF12854.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;