Protein coding transcript 125230

• Transcript: Ll_transcript_465568
• CDS coordinates: 194-514 (+)
• Peptide sequence: MHDRGQPADVITYNSLLDALCKNQQLDEATALLKKIEDQRIQPSVYTYIVLIRGLCNVGRVETAKQVFQHFLIKGYHPDVRICTVMIWGLCKVDSFDEALALKSRTE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_465568

• Blastp: Pentatricopeptide repeat-containing protein At1g62670, mitochondrial from Arabidopsis with 39.22% of identity
• Blastx: Pentatricopeptide repeat-containing protein At1g62670, mitochondrial from Arabidopsis with 36.36% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT1G62670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413117.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;