Protein coding transcript 125237

• Transcript: Ll_transcript_465555
• CDS coordinates: 237-650 (+)
• Peptide sequence: MNQMFQCQRYYSLSFSKFHSFIPHFQYPSFLLRFFSLSLNPTHLNNPLNHAVLSFNHMLHMRNTPTIFEFCKILGSIVKMKHYPIAISLFKRFDHVGIIPNIVAFNILLNCYCHLDQMHCAFSVLAKILKLGYDPVL*
• ORF Type: complete

Annotations of Ll_transcript_465555

• Blastp: Pentatricopeptide repeat-containing protein At1g63130, mitochondrial from Arabidopsis with 39.34% of identity
• Blastx: Pentatricopeptide repeat-containing protein At1g63400 from Arabidopsis with 40.52% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT1G63130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413117.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;