Transcript | Ll_transcript_465284 |
---|---|
CDS coordinates | 1-513 (+) |
Peptide sequence | VICSDKTGTLTTNQMSVTKLVAIGSTVDTLRAFKVEGTTYNPADGRIENWPAGKLDANLEMIAKIAAVCNDAGVAQSEHKFVAHGMPTEAALKVLVEKMGLPEGSKDESSANSSSVLRCSEWWHKHDPRIATLEFDRDRKSMGVIVDSSLGKKSLLVKGAVENLLERSSKI |
ORF Type | internal |
Blastp | Calcium-transporting ATPase 4, endoplasmic reticulum-type from Arabidopsis with 70.18% of identity |
---|---|
Blastx | Calcium-transporting ATPase 4, endoplasmic reticulum-type from Arabidopsis with 70.18% of identity |
Eggnog | P-type atpase(COG0474) |
Kegg | Link to kegg annotations (AT1G07670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425650.1) |
Pfam | Cation transport ATPase (P-type) (PF13246.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer