Protein coding transcript 125294

• Transcript: Ll_transcript_465284
• CDS coordinates: 1-513 (+)
• Peptide sequence: VICSDKTGTLTTNQMSVTKLVAIGSTVDTLRAFKVEGTTYNPADGRIENWPAGKLDANLEMIAKIAAVCNDAGVAQSEHKFVAHGMPTEAALKVLVEKMGLPEGSKDESSANSSSVLRCSEWWHKHDPRIATLEFDRDRKSMGVIVDSSLGKKSLLVKGAVENLLERSSKI
• ORF Type: internal

Annotations of Ll_transcript_465284

• Blastp: Calcium-transporting ATPase 4, endoplasmic reticulum-type from Arabidopsis with 70.18% of identity
• Blastx: Calcium-transporting ATPase 4, endoplasmic reticulum-type from Arabidopsis with 70.18% of identity
• Eggnog: P-type atpase(COG0474)
• Kegg: Link to kegg annotations (AT1G07670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425650.1)
• Pfam: Cation transport ATPase (P-type) (PF13246.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;