| Transcript | Ll_transcript_465018 |
|---|---|
| CDS coordinates | 494-1018 (+) |
| Peptide sequence | MQHPEELGLFVYDEEENETILLHRISSDDIYRKQEDTIISWRDLEYATELALSFHETTGCSYIWDLICNVQRNMHFNTLNSEPFHSVNSQLRELPAVELSTLPLIIKTVVDSGIADQLRLTELILNDQEFLPKLVEVFRVCEDLENMAGLHMIFEIVKGIILLNSTPIFDRIFSD |
| ORF Type | 3prime_partial |
| Blastp | Serine/threonine-protein phosphatase 4 regulatory subunit 3 from Xenopus with 39.66% of identity |
|---|---|
| Blastx | Serine/threonine-protein phosphatase 4 regulatory subunit 3 from Xenopus with 39.66% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (432127) |
| CantataDB | Link to cantataDB annotations (CNT0001838) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019462469.1) |
| Pfam | Component of IIS longevity pathway SMK-1 (PF04802.14) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer