Transcript | Ll_transcript_465021 |
---|---|
CDS coordinates | 175-789 (+) |
Peptide sequence | MRIRHHQRRPVMNWMEIQYNKNRVKVYRLNDDGKWDDQGTGHAAVDYLEHPEELGLFVYDEEENETILLHRISSDDIYRKQEDTIISWRDLEYATELALSFQETSGCSYIWDHICNVQRNMHFNTLNSEPFHSVNSVLRELPAVELSTLPLILKTLVDSGIADQLRLTDLILNDQEFFRKLVEVFRVCEDLENMDGLHMIFRIVK |
ORF Type | 3prime_partial |
Blastp | Serine/threonine-protein phosphatase 4 regulatory subunit 3 from Danio with 40.82% of identity |
---|---|
Blastx | Serine/threonine-protein phosphatase 4 regulatory subunit 3 from Danio with 40.82% of identity |
Eggnog | suppressor of mek1 (Dictyostelium)(ENOG410XQ7A) |
Kegg | Link to kegg annotations (558578) |
CantataDB | Link to cantataDB annotations (CNT0001838) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464836.1) |
Pfam | Component of IIS longevity pathway SMK-1 (PF04802.14) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer