Protein coding transcript 125387

• Transcript: Ll_transcript_465036
• CDS coordinates: 107-412 (+)
• Peptide sequence: MNSGNSNLETRSLLDELSSFNKGGLFDLGHPLLNRVLESFVKAAGIGAVQAVSREAYFTAVEGSGLDNAGGMPLEVGGKKHRLPGLRGETSSKSIEAMVSL*
• ORF Type: complete

Annotations of Ll_transcript_465036

• Blastp: Outer envelope pore protein 16-2, chloroplastic from Arabidopsis with 65.93% of identity
• Blastx: Outer envelope pore protein 16-2, chloroplastic from Arabidopsis with 65.93% of identity
• Eggnog: Mitochondrial import inner membrane translocase subunit Tim17 Tim22 Tim23 family protein(ENOG410YI0M)
• Kegg: Link to kegg annotations (AT4G16160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462799.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;