Transcript | Ll_transcript_463264 |
---|---|
CDS coordinates | 2-823 (+) |
Peptide sequence | PNGQPGHVQSPFSAPNGQPGHVQSPFSAPNGQPGQLQSPFSVSNGQPGQVQYPFSAPSGQLGQVQTPFSAPNGQYGQQPFSSHAGQPNLHGFSLSTGQSTHPPFASQGGQPAQSSGHMYGGFNSQGGSPVATNMSLQSQNGYNGHMNIGNFLPQTPTGQPSQSTYFPHHGGSPSHTTYPMASHSPTNQASQFNNHSFVGQQGNTAPFSSSFTNQSLAPNASQLVVSTGSNSLVSQPPKAKFETKSTVWADTLSKGLVNLNISGPKTNPLADIGI |
ORF Type | internal |
Blastp | Clathrin interactor EPSIN 3 from Arabidopsis with 43.66% of identity |
---|---|
Blastx | Clathrin interactor EPSIN 3 from Arabidopsis with 43.66% of identity |
Eggnog | Clathrin interactor 1(ENOG410XSM0) |
Kegg | Link to kegg annotations (AT3G59290) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429568.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer