Protein coding transcript 125419

• Transcript: Ll_transcript_463270
• CDS coordinates: 161-1108 (+)
• Peptide sequence: MVSPFSEPTGEVTHQSSLAPTSQPTQGISSPADQFPQQAFSAPIGQPGQVHSPFSAPSGQPGQLQSPPSAPNTNSEPGQLQSPFSAPNAQLGQIQSPFSAPNAQPEQVKAPFPAPTTQYRQQTFSSLAGQPNLHGFSLSTGQSTQLPFASQVGQPAQSIGHIYGKLNTQGGSPVAPSISLQSQNGNNVHMNSGNFLPQAPMGQPSQSTNFPHHGGSPSHPTSSMASHSPTNQASLSNNQNITGQQGNAAPFISPFTHQSLAPNASQLAVSTGSNSLVSQSSKDKFETKSTVWADTLSRGLVNLNISGHMTNPLADI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_463270

• Blastp: Clathrin interactor EPSIN 3 from Arabidopsis with 44.19% of identity
• Blastx: Clathrin interactor EPSIN 3 from Arabidopsis with 51.16% of identity
• Eggnog: Clathrin interactor 1(ENOG410XSM0)
• Kegg: Link to kegg annotations (AT3G59290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455965.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;