Protein coding transcript 125470

• Transcript: Ll_transcript_463743
• CDS coordinates: 23-358 (+)
• Peptide sequence: MESDLAQVITANDDLTLEHYQFFLYQLLRGLKYIHTGWLSTIHQLRYFGRIMLRQGGIELLSCVDPFSPRCNICYHFNLTSCLSLSTNNFAFCSVSMGLLFFSTFFIIYCS*
• ORF Type: complete

Annotations of Ll_transcript_463743

• Blastp: Mitogen-activated protein kinase 15 from Oryza sativa with 88.64% of identity
• Blastx: Mitogen-activated protein kinase 16 from Arabidopsis with 88.64% of identity
• Eggnog: Mitogen-activated protein kinase(ENOG410XNY0)
• Kegg: Link to kegg annotations (4350264)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015958685.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;