Transcript | Ll_transcript_462716 |
---|---|
CDS coordinates | 3-416 (+) |
Peptide sequence | NRKLVIATAMMKGEFPERMGQPECQYYLKTGTCKFGATCKFHHPRDQAGIAGRVALNILGYPLRPNEPECTYYLRSGQCKFGNTCKFHHPQPSNMMLSLRGSPVYPAVQSPTTPDHQSYAGGIANWPRASYIASPRWQ |
ORF Type | internal |
Blastp | Zinc finger CCCH domain-containing protein ZFN-like from Pisum with 82.61% of identity |
---|---|
Blastx | Zinc finger CCCH domain-containing protein ZFN-like from Pisum with 82.61% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439883.1) |
Pfam | Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer