| Transcript | Ll_transcript_495682 |
|---|---|
| CDS coordinates | 1-423 (+) |
| Peptide sequence | KRSNMGYVSYVVSLLMCVGFLQMNFAPTTMAQIELNGYRVHILNALPGPMTLRCQSKNNDLGVHVLEKGQTYEWHFHVNLMDSTLYFCHFYWKDKNIRFDVFRTAHEGTCNSQCFWEAKEDGFYFHCDTRTYTQLHTWTS* |
| ORF Type | 5prime_partial |
| Blastp | S-protein homolog 6 from Arabidopsis with 42.53% of identity |
|---|---|
| Blastx | S-protein homolog 6 from Arabidopsis with 42.53% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020220440.1) |
| Pfam | Plant self-incompatibility protein S1 (PF05938.10) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer