Transcript | Ll_transcript_462718 |
---|---|
CDS coordinates | 71-445 (+) |
Peptide sequence | MSGMYYFLRMHKYYLKTGTCKFGATCKFHHPRDQAGIAGRVALNILGYPLRPNEPECTYYLRSGQCKFGNTCKFHHPQPSNMMLSLRGSPVYPAVQSPTTPDHQSYAGGIANWPRASYIASPRWQ |
ORF Type | 3prime_partial |
Blastp | Zinc finger CCCH domain-containing protein ZFN-like from Pisum with 80.7% of identity |
---|---|
Blastx | Zinc finger CCCH domain-containing protein ZFN-like from Pisum with 80.7% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439888.1) |
Pfam | Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer