Transcript | Ll_transcript_462734 |
---|---|
CDS coordinates | 781-1812 (+) |
Peptide sequence | MHKYYLKTGTCKFGATCKFHHPRDQAGIAGRVALNILGYPLRPNEPECTYYLRSGQCKFGNTCKFHHPQPSNMMLSLRGSPVYPAVQSPTTPDHQSYAGGIANWPRASYIASPRWQGPSSYTPLILPQGMVSVPGWSAYSGQMGSISISDSPQQTVGTGQTYGNSRQVEIANASLQGPYSQFRSGSVPLGFYALQRDNIFPERPGQPECPFYIKTGDCKFGAVCRFHHPCERLIPIPDCVLSPMGLPLRPGEPLCVFYSRYSICKFGPSCKFDHPMGIFTYNASTSPSAEVPGRRLLGSSSGTPALNLSSEGLVESGSAKPRRLSISETRQIPSSDDDIDDEG* |
ORF Type | complete |
Blastp | Zinc finger CCCH domain-containing protein ZFN-like from Pisum with 80.65% of identity |
---|---|
Blastx | Zinc finger CCCH domain-containing protein ZFN-like from Pisum with 80.65% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439888.1) |
Pfam | Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer