Protein coding transcript 125536

• Transcript: Ll_transcript_462991
• CDS coordinates: 3-503 (+)
• Peptide sequence: RLENRISERSENRISETVGFSLKNKMLGDEIGKGAYGWVFKGLDLENGDFVAIKQVSLENIAQEDLNVIMQEIDLLKNLNHKNIVKYLGSLKTKSHLHIILEYVENGSLANIIKPNKFGPFPESLVAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLAD
• ORF Type: internal

Annotations of Ll_transcript_462991

• Blastp: MAP3K epsilon protein kinase 1 from Arabidopsis with 93.92% of identity
• Blastx: MAP3K epsilon protein kinase 1 from Arabidopsis with 93.92% of identity
• Eggnog: mitogen-activated protein kinase kinase kinase(ENOG410XQGS)
• Kegg: Link to kegg annotations (AT3G13530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454260.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;