Transcript | Ll_transcript_463016 |
---|---|
CDS coordinates | 1-579 (+) |
Peptide sequence | RLENRICERLENRISERSENRISERLENRISQRWENRISETVGFSLKNKASAPTKSGVPSKEQTMLEGQKTKNHGFTQSKTLGNKYMLGDEIGKGAYGRVFKGLDLENRHFVAIKQFSLENIAQLNVIMQEIHVLKNLNHKNIVRYLGSFKTKSYLHIILEYVENGSLANIIKPNKFGPFPEPLVAVYIAQV* |
ORF Type | 5prime_partial |
Blastp | MAP3K epsilon protein kinase 1 from Arabidopsis with 84.87% of identity |
---|---|
Blastx | MAP3K epsilon protein kinase 1 from Arabidopsis with 84.87% of identity |
Eggnog | mitogen-activated protein kinase kinase kinase(ENOG410XQGS) |
Kegg | Link to kegg annotations (AT3G13530) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016186784.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer