Protein coding transcript 125545

• Transcript: Ll_transcript_463017
• CDS coordinates: 151-660 (+)
• Peptide sequence: MSRQTTSSAFTKSKTLDNKYMLGDEIGKGAYGRVFKGLDLENGDFVAIKQVSLENIAQEDLNIIMQKIDLLKNLNHKNIVRYLGSFKTKSYLHIILEYVENGSLANIIKPNKFGPFPESLVAVYIAQVLEGLVYLHEQGVIHQDIKGANILTTKEGLVKLADFGVIHQDI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_463017

• Blastp: MAP3K epsilon protein kinase 1 from Arabidopsis with 92.12% of identity
• Blastx: MAP3K epsilon protein kinase 1 from Arabidopsis with 92.12% of identity
• Eggnog: mitogen-activated protein kinase kinase kinase(ENOG410XQGS)
• Kegg: Link to kegg annotations (AT3G13530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454259.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;