Transcript | Ll_transcript_462997 |
---|---|
CDS coordinates | 3-470 (+) |
Peptide sequence | EADVNIHSVVGTPYWMAPEVIEMSVVCAASDIWSVGCTVIELLTCVPPYYDLHPMQALFRIVQDERPPIPESLSPDITDFLHHCFQKDARQRPDAKTLLSHPWIQNRRRTIVDVDLDDQARVTDNNSNKCNRVSPGQPILNCDLYINLAGSSSLER |
ORF Type | internal |
Blastp | MAP3K epsilon protein kinase 1 from Brassica with 86.49% of identity |
---|---|
Blastx | MAP3K epsilon protein kinase 1 from Brassica with 86.49% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454259.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer