Protein coding transcript 125554

• Transcript: Ll_transcript_462997
• CDS coordinates: 3-470 (+)
• Peptide sequence: EADVNIHSVVGTPYWMAPEVIEMSVVCAASDIWSVGCTVIELLTCVPPYYDLHPMQALFRIVQDERPPIPESLSPDITDFLHHCFQKDARQRPDAKTLLSHPWIQNRRRTIVDVDLDDQARVTDNNSNKCNRVSPGQPILNCDLYINLAGSSSLER
• ORF Type: internal

Annotations of Ll_transcript_462997

• Blastp: MAP3K epsilon protein kinase 1 from Brassica with 86.49% of identity
• Blastx: MAP3K epsilon protein kinase 1 from Brassica with 86.49% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454259.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;