Protein coding transcript 125565

• Transcript: Ll_transcript_463544
• CDS coordinates: 385-909 (+)
• Peptide sequence: MKSAEEAWQKQIASLQTSLVAARRSLTSENGTIQHARNDVVPTHDDSEEATSIGPLATGPSTPVKFSTALPVSDGGRQANGTSATVTTLMKEFEQRRQNFDEEVKVLNERKQGQSAKANNIQELRKLKERFEGWKKQYKIKLHETKARLLKSEGGKSRWSWWEKLRLKDKGLLS*
• ORF Type: complete

Annotations of Ll_transcript_463544

• Blastp: Myosin-2 from Arabidopsis with 45.14% of identity
• Blastx: Myosin-2 from Arabidopsis with 45.21% of identity
• Eggnog: myosin heavy chain(COG5022)
• Kegg: Link to kegg annotations (AT5G54280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449127.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;