Protein coding transcript 125632

• Transcript: Ll_transcript_463207
• CDS coordinates: 233-793 (+)
• Peptide sequence: MSRVEERWERLVRAALRRERTGGDAYGRPVGGIAGNVPSALAKNRDIDEILRVADEIQDEDPNISRILCEHAYSLSQNLDPNSEGRGVLQFKTGLMSVIKQKLAKREVGTIDRSQDIARLQEFYKLYREKNKVDRLREEETKLRESGAFSRENLGEYVFLTNQMGVTHLNHSVLPLFPSPWGITCL*
• ORF Type: complete

Annotations of Ll_transcript_463207

• Blastp: Callose synthase 9 from Arabidopsis with 79.61% of identity
• Blastx: Callose synthase 9 from Arabidopsis with 80.3% of identity
• Eggnog: synthase(ENOG410XQ8V)
• Kegg: Link to kegg annotations (AT3G07160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441612.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;