Transcript | Ll_transcript_463208 |
---|---|
CDS coordinates | 2-487 (+) |
Peptide sequence | HSVGAIVGNVPSALAKNRDIDEILRVANGIQDEDPNISRILCEHAYSLSQSLDPNSEGRGVLQFKTGLLSVIKQKLAKREVGTIDRSQDVARLQEFYKLYRDNNNADKLREEETKLRESGAFSRQILSENCLSTFLGVKKLRFQKLWSISYRSWCNSSHVC* |
ORF Type | 5prime_partial |
Blastp | Callose synthase 9 from Arabidopsis with 77.05% of identity |
---|---|
Blastx | Callose synthase 9 from Arabidopsis with 77.05% of identity |
Eggnog | synthase(ENOG410XQ8V) |
Kegg | Link to kegg annotations (AT3G07160) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428289.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer