| Transcript | Ll_transcript_463209 |
|---|---|
| CDS coordinates | 2-487 (+) |
| Peptide sequence | HSVGAIVGNVPSALAKNRDIDEILRVANGIQDEDPNISRILCEHAYSLSQSLDPNSEGRGVLQFKTGLLSVIKQKLAKREVGTIDRSQDVARLQEFYKLYRDNNNADKLREEETKLRESGAFSRQILSENCLSTFLGVKKLRFQKLWSISYRSWCNSSHVC* |
| ORF Type | 5prime_partial |
| Blastp | Callose synthase 9 from Arabidopsis with 77.05% of identity |
|---|---|
| Blastx | Callose synthase 9 from Arabidopsis with 77.05% of identity |
| Eggnog | synthase(ENOG410XQ8V) |
| Kegg | Link to kegg annotations (AT3G07160) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019428289.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer