Protein coding transcript 125643

• Transcript: Ll_transcript_463657
• CDS coordinates: 657-1289 (+)
• Peptide sequence: MRNSGEETIPRWPWFVFLAGGMGALACSSLSHLLACHSKRFNLFFWRLDYAGISLMIVCSFFAPIYYAFFCNPYARLFYLTSISGLGVLTTVTLLAPSLSSPRFRSLRASLFLSMGFSGVIPVIHALALYWGQPHIFVALGYELAMALLYATGAGIYVARIPERWKPGAFDIAGHSHQIFHVFVVLGALAHSVATLVILNFRLGSPTCAF*
• ORF Type: complete

Annotations of Ll_transcript_463657

• Blastp: Heptahelical transmembrane protein 2 from Arabidopsis with 75.98% of identity
• Blastx: Heptahelical transmembrane protein 2 from Arabidopsis with 70.67% of identity
• Eggnog: Channel protein (Hemolysin III family(COG1272)
• Kegg: Link to kegg annotations (AT4G30850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441804.1)
• Pfam: Haemolysin-III related (PF03006.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;