Protein coding transcript 125651

• Transcript: Ll_transcript_480884
• CDS coordinates: 1-390 (+)
• Peptide sequence: VHIRVQHQIAFIFNGQVVIDKSLPFKSNNYSKILSVSPIAVPASSRAQFSVKGINLIRSATRLICALEGKYLVCEDAHESMDQHSKELDEIRCIQFSCSVPVMNGRGFIEVLFLCSCKLSTEKSRENTD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_480884

• Blastp: Squamosa promoter-binding-like protein 1 from Arabidopsis with 46.96% of identity
• Blastx: Squamosa promoter-binding-like protein 1 from Arabidopsis with 46.96% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG4110DQF)
• Kegg: Link to kegg annotations (AT2G47070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441265.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;