Protein coding transcript 125653

• Transcript: Ll_transcript_480888
• CDS coordinates: 1-624 (+)
• Peptide sequence: VHIRVQHQIAFIFNGQVVIDKSLPFKSNNYSKILSVSPIAVPASSRAQFSVKGINLIRSATRLICALEGKYLVCEDAHESMDQHSKELDEIRCIQFSCSVPVMNGRGFIEIEDQGLSSSFFPFIVVEEDVCSEICLLEPLLELSETDPDTDGTGKIEAKSQAMDFIHEMGWLLHRNQLTSRMVHLKSSAELFPLKRFKWLMEFSMDHD
• ORF Type: internal

Annotations of Ll_transcript_480888

• Blastp: Squamosa promoter-binding-like protein 1 from Arabidopsis with 51.17% of identity
• Blastx: Squamosa promoter-binding-like protein 1 from Arabidopsis with 51.17% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG4110DQF)
• Kegg: Link to kegg annotations (AT2G47070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427869.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;