Protein coding transcript 125664

• Transcript: Ll_transcript_480880
• CDS coordinates: 261-926 (+)
• Peptide sequence: MDRHSKELDEIQCIKFSCSVPVMNGRGFIEIEDQGLSSSFFPFIVVEEDVCSEICVLEPLLQLSETDLDIDGTGKIEAKNQALDFIHEMGWLLHRNRLKSRMVHLNSSAESFPLKRFKWLMEFSMDHDWCAVVKKLLNLLLDGTVNSGDHPSLYLALSEMALLHRAVRRNSKQLVDLLLRYVPENVSDKLGTENKALRGEESLFRPDVAGPAGLTPLHIAAG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_480880

• Blastp: Squamosa promoter-binding-like protein 1 from Arabidopsis with 53.52% of identity
• Blastx: Squamosa promoter-binding-like protein 1 from Arabidopsis with 51.22% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG4110DQF)
• Kegg: Link to kegg annotations (AT2G47070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452331.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;