| Transcript | Ll_transcript_481816 |
|---|---|
| CDS coordinates | 209-589 (+) |
| Peptide sequence | MSKLRMLMISRMAKPEEVLIVEDENGNVVRETMKDNDVLVQYKIMRETLIYLSHLDHDDTEKQMLRKLSKQLSGEDWTWNTLNTLCWAIGSISGSMMEEQENRFLVMVIRDLLNLCEITKGKDNKAV |
| ORF Type | 3prime_partial |
| Blastp | Protein EXPORTIN 1A from Arabidopsis with 92.91% of identity |
|---|---|
| Blastx | Protein EXPORTIN 1A from Arabidopsis with 80.61% of identity |
| Eggnog | exportin(COG5101) |
| Kegg | Link to kegg annotations (AT5G17020) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019444596.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer