Protein coding transcript 125727

• Transcript: Ll_transcript_481825
• CDS coordinates: 56-676 (+)
• Peptide sequence: MMEEQENRFLVMVIRDLLNLCEITKGKDNKAVIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHPGVQDMACDTFLKIVQKCRRKFVITQVGENEPFVSELLTGLPTTIADLEPHQIHAFYESVGNMVQAESDTQKRDEYLQRLMELPNQKWLEIIGQARQNVDFLKEQDVIRIVLNILQTNTSVASSLGTYFLPQISLIF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_481825

• Blastp: Protein EXPORTIN 1A from Arabidopsis with 89.86% of identity
• Blastx: Protein EXPORTIN 1A from Arabidopsis with 90.22% of identity
• Eggnog: exportin(COG5101)
• Kegg: Link to kegg annotations (AT5G17020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420984.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;