Protein coding transcript 125741

• Transcript: Ll_transcript_479128
• CDS coordinates: 58-525 (+)
• Peptide sequence: MAEAASFANEWVPFCRKHDIEPRNPESYFSLKRDPYKNKVKSDFVKDRRRLKREYDEFKVRINSLPDSIRRRSDAYHAREEIKAMKLQRQTREDEPIETPKIPKATWMADGTHWPGTWLSPTSEHSKGDHAGIIQVMLKPPSDEPLLGGADDAKLI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_479128

• Blastp: Cellulose synthase-like protein D2 from Arabidopsis with 87.84% of identity
• Blastx: Cellulose synthase-like protein D2 from Arabidopsis with 89.22% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (AT5G16910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423665.1)
• Pfam: Cellulose synthase (PF03552.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;