Transcript | Ll_transcript_481563 |
---|---|
CDS coordinates | 223-1014 (+) |
Peptide sequence | MAAIGASLCPAASFPAHRREEPSHTVLKLKPNRIPIMPPCFALSVDRVLETTTTAISANNGVASVKVNGEEGISAEKEKRGENKKEEEELNRRSGWRSYVEQLKEISKQDGGPPRWFSPLESGSRLDKSPLLLFLPGIDGVGLGLTLHHQKLGSIFDVWCLHIPVADRTPFTELVKIVEKTVRSEHQRLPNRPIYLVGESLGGSLALAVAARIPDINIVLILANPATSFDRSQLQLLTPLLQAMRGPLSLFPPEILSSLSGSC* |
ORF Type | complete |
Blastp | Acyltransferase-like protein At3g26840, chloroplastic from Arabidopsis with 60.54% of identity |
---|---|
Blastx | Acyltransferase-like protein At3g26840, chloroplastic from Arabidopsis with 60.54% of identity |
Eggnog | Acyltransferase(COG0204) |
Kegg | Link to kegg annotations (AT3G26840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437419.1) |
Pfam | Serine aminopeptidase, S33 (PF12146.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer