Transcript | Ll_transcript_481543 |
---|---|
CDS coordinates | 223-1341 (+) |
Peptide sequence | MAAIGASLSPAASFPVYRREEPSQTVLKLKANRIPIMPPCFALSVDRVLETTTTAISANNGVASVKVNGEEGISAEKEKRGENKKEEEELNRRSGWRSYVEQSKEIAKPDGGPPRWFSPLESGSRLDKSPLLLFLPGIDGVGLGLTLHHQKLGSIFDVWCLHIPVADRTPFTEFVKIVEKTVRSEHQRLPNRPIYLVGESLGGCLAMAVAAHIPDIDVVLILANPATSFGRSQLQLLTPLMEAMHGPLSLFPPEILSSISGDPLKLLDNLVRGFPLQNTAKELLEDFITFSGSLPVLANILPIETLQWKLKLLKSGSAYVNSRLHAIKAQTLILCSGNDRLLPSQQEGERLCQLLPRCELGKFEGSGHFLFLE |
ORF Type | 3prime_partial |
Blastp | Acyltransferase-like protein At1g54570, chloroplastic from Arabidopsis with 47.43% of identity |
---|---|
Blastx | Acyltransferase-like protein At1g54570, chloroplastic from Arabidopsis with 51.06% of identity |
Eggnog | Acyltransferase(COG0204) |
Kegg | Link to kegg annotations (AT1G54570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437418.1) |
Pfam | alpha/beta hydrolase fold (PF00561.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer