Protein coding transcript 125965

• Transcript: Ll_transcript_481632
• CDS coordinates: 927-1385 (+)
• Peptide sequence: MKVVTVDRNHISDNVAVTPYRESRYGMGSETPMHPSRTPLHPYMTPMRDPGATPIHDGMRTPMRDRAWNPYTPMSPPRDNWEDGNPGSWGASPQYQPGSPASRPYEAPTPGAGWASTPGGNYSEAGTPRDSSAYGSIICYLPPVVNSIYRIAA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_481632

• Blastp: Putative transcription elongation factor SPT5 homolog 1 from Arabidopsis with 86.23% of identity
• Blastx: Putative transcription elongation factor SPT5 homolog 1 from Arabidopsis with 72.73% of identity
• Eggnog: Transcription elongation factor(COG5164)
• Kegg: Link to kegg annotations (AT4G08350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415219.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;