Protein coding transcript 12598

• Transcript: Ll_transcript_411746
• CDS coordinates: 721-1107 (+)
• Peptide sequence: MITTVLSVLYSALRAGSSTTFLTPPSSPRSGENKPLLEEEMEEGKTKKEEKEAKPVSYSYSFFHLIFALATMYSAMLLSGWTSSNEGTDLIDVGWTSVWVRIGTEWVTAGLYIWTLVAPSLFPDREFA*
• ORF Type: complete

Annotations of Ll_transcript_411746

• Blastp: Serine incorporator 3 from Pongo with 34.11% of identity
• Blastx: Serine incorporator 1 from Bos with 30.56% of identity
• Eggnog: serine incorporator(ENOG410XP7K)
• Kegg: Link to kegg annotations (100173651)
• CantataDB: Link to cantataDB annotations (CNT0002349)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426195.1)
• Pfam: Serine incorporator (Serinc) (PF03348.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;