Transcript | Ll_transcript_411747 |
---|---|
CDS coordinates | 2071-2457 (+) |
Peptide sequence | MITTVLSVLYSALRAGSSTTFLTPPSSPRSGENKPLLEEEMEEGKTKKEEKEAKPVSYSYSFFHLIFALATMYSAMLLSGWTSSNEGTDLIDVGWTSVWVRIGTEWVTAGLYIWTLVAPSLFPDREFA* |
ORF Type | complete |
Blastp | Probable serine incorporator from Monosiga with 33.33% of identity |
---|---|
Blastx | Serine incorporator 3 from Pongo with 28.88% of identity |
Eggnog | serine incorporator(ENOG410XP7K) |
Kegg | Link to kegg annotations (MONBRDRAFT_18904) |
CantataDB | Link to cantataDB annotations (CNT0002349) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426195.1) |
Pfam | Serine incorporator (Serinc) (PF03348.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer